Your privacy is very important to us.When you visit our website,please agree to the use of all cookies.For more information about personal data processing,please go to Privacy.

Recombinant Human ACTG2 Protein

Catalog No. P66654PA
  • SDS-PAGE of the product

    The purified product was run on 15% SDS-PAGE at reducing conditions. The gel was stained with Coomassie brilliant blue and destained.

Associated Products
  • There are no related products

Product information
Protein general information
    • Product name

      Recombinant Human ACTG2 Protein

    • Predicted molecular mass

      19.5 kDa

    • Expression host

      Escherichia coli

    • Purification tag

      6xHis at C-terminus

    • Solubility

      Soluble

    • Buffer

      0.15 M Phosphate buffered saline, pH 7.4

    • Shipping, storage and shelf life

      Shipped on dry ice. Avoid repeated freeze-thaw cycles.
      Upon receipt,
      * 2 days when stored at 2 to 8 °C after thawing
      * Up to 12 months when aliquoted and stored at -20 to -80 °C

    • Protein name

      Actin gamma 2, smooth muscle

    • Alternative protein names

      Actin, gamma-enteric smooth muscle; Alpha-actin-3; Gamma-2-actin; Smooth muscle gamma- actin

    • Gene name

      ACTG2

    • Alternative gene name

      ACTA3; ACTL3; ACTSG

    • Accession

      P63267

    • Organism

      Homo sapiens (Human)

    • Full length

      376 amino acids

Core sequence
  • Core sequence start:
    Glu101
    Core sequence stop:
    Thr250

    ......EHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSS SLEKSYELPDGQVIT......

Note

The core sequence of the recombinant protein is shown above. The N and C termini have shortened by 0-10 amino acids. The exact sequence is proprietary information powered by SIEVE®.